Anti-RPL34 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA035139
- Bilder (8)
| Artikelname: | Anti-RPL34 Antibody , Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA035139 |
| Hersteller Artikelnummer: | HPA035139 |
| Alternativnummer: | ATA-HPA035139-100,ATA-HPA035139-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | L34 |
| ribosomal protein L34 |
| Anti-RPL34 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 6164 |
| UniProt: | P49207 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MVQRLTYRRRLSYNTASNKTRLSRTPGNRIVYLYTKKVGKAPKSACGVCPGRLRG |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | RPL34 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli, cytosol & endoplasmic reticulum. |
|
|
Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells. |
|
|
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human cell line HEK 293 |
|
|
HPA035139 |
|
|
HPA035139 |
|
|
HPA035139 |
|
|
HPA035139 |
|
|
HPA035139 |
Produktgarantie und fachkundiger Support
