Anti-GSTM3
Artikelnummer:
ATA-HPA035190
- Bilder (7)
| Artikelname: | Anti-GSTM3 |
| Artikelnummer: | ATA-HPA035190 |
| Hersteller Artikelnummer: | HPA035190 |
| Alternativnummer: | ATA-HPA035190-100,ATA-HPA035190-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | GST5 |
| glutathione S-transferase mu 3 (brain) |
| Anti-GSTM3 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 2947 |
| UniProt: | P21266 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | TYDILDQNRIFDPKCLDEFPNLKAFMCRFEALEKIAAYLQSDQFCKMPINN |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | GSTM3 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human testis and lymph node tissues using Anti-GSTM3 antibody. Corresponding GSTM3 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows high expression. |
|
|
Immunohistochemical staining of human lymph node shows low expression as expected. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 |
|
|
HPA035190-100ul |
|
|
HPA035190-100ul |
|
|
HPA035190-100ul |
Produktgarantie und fachkundiger Support
