Anti-SLC1A5
Artikelnummer:
ATA-HPA035239
- Bilder (7)
| Artikelname: | Anti-SLC1A5 |
| Artikelnummer: | ATA-HPA035239 |
| Hersteller Artikelnummer: | HPA035239 |
| Alternativnummer: | ATA-HPA035239-100,ATA-HPA035239-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | AAAT, ASCT2, M7V1, RDRC |
| solute carrier family 1 (neutral amino acid transporter), member 5 |
| Anti-SLC1A5 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 6510 |
| UniProt: | Q15758 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MVADPPRDSKGLAAAEPTANGGLALASIEDQGAAAGGYCGSRDQVRRCLRAN |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SLC1A5 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane. |
|
|
Immunohistochemical staining of human epididymis shows strong cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis in human cell line A-549. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and SLC1A5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY417160). |
|
|
HPA035239-100ul |
|
|
HPA035239-100ul |
|
|
HPA035239-100ul |
Produktgarantie und fachkundiger Support
