Anti-SCML1 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA035270
Artikelname: Anti-SCML1 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA035270
Hersteller Artikelnummer: HPA035270
Alternativnummer: ATA-HPA035270-100,ATA-HPA035270-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: SCML1
sex comb on midleg-like 1 (Drosophila)
Anti-SCML1
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 6322
UniProt: Q9UN30
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: WTNHKPYGYKKHSYRLVKKLKLQKMKKNEVYETFSYPESYSPTLPVSRRENNSPSNLPRPSFCMEEYQRAELEEDPILSRTPSPVHPSD
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SCML1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200
Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nucleoli.
Immunohistochemistry analysis in human testis and prostate tissues using Anti-SCML1 antibody. Corresponding SCML1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows high expression.
Immunohistochemical staining of human prostate shows low expression as expected.
HPA035270
HPA035270
HPA035270