Anti-FGFR2
Artikelnummer:
ATA-HPA035305
- Bilder (7)
| Artikelname: | Anti-FGFR2 |
| Artikelnummer: | ATA-HPA035305 |
| Hersteller Artikelnummer: | HPA035305 |
| Alternativnummer: | ATA-HPA035305-100,ATA-HPA035305-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | BEK, CD332, CEK3, CFD1, ECT1, JWS, K-SAM, KGFR, TK14, TK25 |
| fibroblast growth factor receptor 2 |
| Anti-FGFR2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 2263 |
| UniProt: | P21802 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | PPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISWTKDGVHLGPNNRTVLIGEYLQIKGATPRDSGLYACTASRTVDSETWYFMV |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | FGFR2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human skeletal muscle shows low positivity as expected. |
|
|
Immunohistochemical staining of human endometrium shows moderate membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human prostate shows moderate membranous positivity in glandular cells and weak cytoplasmic staining of smooth muscle cells. |
|
|
Immunohistochemical staining of human Fallopian tube shows moderate membranous positivity in glandular cells. |
|
|
HPA035305-100ul |
|
|
HPA035305-100ul |
|
|
HPA035305-100ul |
Produktgarantie und fachkundiger Support
