Anti-GALM
Artikelnummer:
ATA-HPA035472
- Bilder (9)
| Artikelname: | Anti-GALM |
| Artikelnummer: | ATA-HPA035472 |
| Hersteller Artikelnummer: | HPA035472 |
| Alternativnummer: | ATA-HPA035472-100,ATA-HPA035472-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | GALM |
| galactose mutarotase (aldose 1-epimerase) |
| Anti-GALM |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 130589 |
| UniProt: | Q96C23 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | YPGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFNLAGQASPNINDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRK |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | GALM |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human kidney and skin tissues using Anti-GALM antibody. Corresponding GALM RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human adrenal gland, cerebral cortex, kidney and skin using Anti-GALM antibody HPA035472 (A) shows similar protein distribution across tissues to independent antibody HPA035473 (B). |
|
|
Immunohistochemical staining of human kidney shows high expression. |
|
|
Immunohistochemical staining of human skin shows low expression as expected. |
|
|
Immunohistochemical staining of human adrenal gland using Anti-GALM antibody HPA035472. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-GALM antibody HPA035472. |
|
|
HPA035472-100ul |
|
|
HPA035472-100ul |
|
|
HPA035472-100ul |
Produktgarantie und fachkundiger Support
