Anti-TTC21B
Artikelnummer:
ATA-HPA035495
- Bilder (9)
| Artikelname: | Anti-TTC21B |
| Artikelnummer: | ATA-HPA035495 |
| Hersteller Artikelnummer: | HPA035495 |
| Alternativnummer: | ATA-HPA035495-100,ATA-HPA035495-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ11457, IFT139, JBTS11, NPHP12, THM1 |
| tetratricopeptide repeat domain 21B |
| Anti-TTC21B |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 79809 |
| UniProt: | Q7Z4L5 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | ALAHEPVNELSALMEDGRCQVLLAKVYSKMEKLGDAITALQQARELQARVLKRVQMEQPDAVPAQKHLAAEICAEIAKHSVAQRDYE |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | TTC21B |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to mitochondria. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected. |
|
|
Immunohistochemical staining of human fallopian tube shows moderate to strong membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human colon shows strong membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human testis shows weak cytoplasmic/membranous positivity in cells in seminiferous ducts. |
|
|
HPA035495-100ul |
|
|
|
|
|
HPA035495-100ul |
|
|
HPA035495-100ul |
Produktgarantie und fachkundiger Support
