Anti-LRRC15
Artikelnummer:
ATA-HPA035503
- Bilder (7)
| Artikelname: | Anti-LRRC15 |
| Artikelnummer: | ATA-HPA035503 |
| Hersteller Artikelnummer: | HPA035503 |
| Alternativnummer: | ATA-HPA035503-100,ATA-HPA035503-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | LIB |
| leucine rich repeat containing 15 |
| Anti-LRRC15 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 131578 |
| UniProt: | Q8TF66 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | NWLLLNQPRLGTDTVPVCFSPANVRGQSLIIINVNVAVPSVHVPEVPSYPETPWYPDTPSYPDTTSVSSTTELTSPVEDYTDLTTIQVTDDRSVW |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | LRRC15 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human endometrium shows moderate membranous positivity in glandular cells. |
|
|
Immunohistochemical staining of human stomach shows moderate positivity in apical membranes in glandular cells. |
|
|
Immunohistochemical staining of human skin shows moderate membranous and weaker cytoplasmic positivity in epidermal cells. |
|
|
Immunohistochemical staining of human testis shows only weak positivity in cells in seminiferous ducts as expected. |
|
|
HPA035503-100ul |
|
|
HPA035503-100ul |
|
|
HPA035503-100ul |
Produktgarantie und fachkundiger Support
