Anti-PPP2R3A
Artikelnummer:
ATA-HPA035829
- Bilder (7)
| Artikelname: | Anti-PPP2R3A |
| Artikelnummer: | ATA-HPA035829 |
| Hersteller Artikelnummer: | HPA035829 |
| Alternativnummer: | ATA-HPA035829-100,ATA-HPA035829-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PPP2R3 |
| protein phosphatase 2, regulatory subunit B, alpha |
Anti-PPP2R3A |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 5523 |
| UniProt: | Q06190 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | EQRDPFAVQKDVENDGPEPSDWDRFAAEEYETLVAEESAQAQFQEGFEDYETDEPASPSEFGNKSNKILSASLPEKCGKLQSVDEE |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PPP2R3A |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human hippocampus shows moderate cytoplasmic positivity in neuronal cells. |
|
|
Western blot analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-PPP2R3A antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH. |
|
|
Western blot analysis in human cell lines A-431 and HeLa using Anti-PPP2R3A antibody. Corresponding PPP2R3A RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH. |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA035829-100ul |
|
|
HPA035829-100ul |
|
|
HPA035829-100ul |
Produktgarantie und fachkundiger Support
