Anti-CD33
Artikelnummer:
ATA-HPA035832
- Bilder (7)
| Artikelname: | Anti-CD33 |
| Artikelnummer: | ATA-HPA035832 |
| Hersteller Artikelnummer: | HPA035832 |
| Alternativnummer: | ATA-HPA035832-100,ATA-HPA035832-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ00391, p67, SIGLEC-3, SIGLEC3 |
| CD33 molecule |
| Anti-CD33 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 945 |
| UniProt: | P20138 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | KTHRRKAARTAVGRNDTHPTTGSASPKHQKKSKLHGPTETSSCSGAAPTVEMDEELHYASLNFHGMNPSKDTSTEYSEVRTQ |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CD33 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human lung shows moderate positivity in macrophages. |
|
|
Immunohistochemical staining of human lymph node shows moderate positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human placenta shows moderate positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
HPA035832-100ul |
|
|
HPA035832-100ul |
|
|
HPA035832-100ul |
Produktgarantie und fachkundiger Support
