Anti-CSN3 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA035953
Artikelname: Anti-CSN3 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA035953
Hersteller Artikelnummer: HPA035953
Alternativnummer: ATA-HPA035953-100,ATA-HPA035953-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CSN10
casein kappa
Anti-CSN3
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 1448
UniProt: P07498
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: PAVVRPHAQIPQRQYLPNSHPPTVVRRPNLHPSFIAIPPKKIQDKIIIPTINTIATVEPTPA
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CSN3
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemical staining of human breast, colon, liver and testis using Anti-CSN3 antibody HPA035953 (A) shows similar protein distribution across tissues to independent antibody HPA035954 (B).
Immunohistochemical staining of human testis using Anti-CSN3 antibody HPA035953.
Immunohistochemical staining of human colon using Anti-CSN3 antibody HPA035953.
Immunohistochemical staining of human breast using Anti-CSN3 antibody HPA035953.
Immunohistochemical staining of human liver using Anti-CSN3 antibody HPA035953.
HPA035953
HPA035953
HPA035953