Anti-PDCD1

Artikelnummer: ATA-HPA035981
Artikelname: Anti-PDCD1
Artikelnummer: ATA-HPA035981
Hersteller Artikelnummer: HPA035981
Alternativnummer: ATA-HPA035981-100,ATA-HPA035981-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CD279, hSLE1, PD1, SLEB2
programmed cell death 1
Anti-PDCD1
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 5133
UniProt: Q15116
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: WFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAIS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PDCD1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human lymph node and liver tissues using HPA035981 antibody. Corresponding PDCD1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in germinal center cells.
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in germinal center cells.
Western blot analysis in control (vector only transfected HEK293T lysate) and pDCD1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401555).
HPA035981-100ul
HPA035981-100ul
HPA035981-100ul