Anti-BDH2

Artikelnummer: ATA-HPA036029
Artikelname: Anti-BDH2
Artikelnummer: ATA-HPA036029
Hersteller Artikelnummer: HPA036029
Alternativnummer: ATA-HPA036029-100,ATA-HPA036029-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: DHRS6, FLJ13261, PRO20933, SDR15C1, UCPA-OR, UNQ6308
3-hydroxybutyrate dehydrogenase, type 2
Anti-BDH2
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 56898
UniProt: Q9BUT1
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: EGAKVIATDINESKLQELEKYPGIQTRVLDVTKKKQIDQFANEVERLDVLFNVAGFVHHGTVLDCEEKDWDFS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: BDH2
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry analysis in human kidney and skeletal muscle tissues using Anti-BDH2 antibody. Corresponding BDH2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human kidney shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human Kidney tissue
HPA036029-100ul
HPA036029-100ul
HPA036029-100ul