Anti-BSG

Artikelnummer: ATA-HPA036048
Artikelname: Anti-BSG
Artikelnummer: ATA-HPA036048
Hersteller Artikelnummer: HPA036048
Alternativnummer: ATA-HPA036048-100,ATA-HPA036048-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CD147, EMMPRIN, OK
basigin (Ok blood group)
Anti-BSG
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 682
UniProt: P35613
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: DLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIEN
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: BSG
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:2500 - 1:5000, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human heart muscle and pancreas tissues using Anti-BSG antibody. Corresponding BSG RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human heart muscle shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
HPA036048-100ul
HPA036048-100ul
HPA036048-100ul