Anti-RNPEP

Artikelnummer: ATA-HPA036074
Artikelname: Anti-RNPEP
Artikelnummer: ATA-HPA036074
Hersteller Artikelnummer: HPA036074
Alternativnummer: ATA-HPA036074-100,ATA-HPA036074-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: RNPEP
arginyl aminopeptidase (aminopeptidase B)
Anti-RNPEP
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 6051
UniProt: Q9H4A4
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: MKPAEELAQLWAAEELDMKAIEAVAISPWKTYQLVYFLDKILQKSPLPPGNVKKLGDTYPSISNARNAELRLRWGQI
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: RNPEP
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & the Golgi apparatus.
Immunohistochemical staining of human gallbladder shows moderate cytoplasmic positivity in glandular cells.
Western blot analysis using Anti-RNPEP antibody HPA036074 (A) shows similar pattern to independent antibody HPA036075 (B).
HPA036074-100ul
HPA036074-100ul
HPA036074-100ul