Anti-TRAIP Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA036261
Artikelname: Anti-TRAIP Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA036261
Hersteller Artikelnummer: HPA036261
Alternativnummer: ATA-HPA036261-100,ATA-HPA036261-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: RNF206, TRIP
TRAF interacting protein
Anti-TRAIP
Klonalität: Polyclonal
Konzentration: 0.4 mg/ml
Isotyp: IgG
NCBI: 10293
UniProt: Q9BWF2
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: QSQRPEVEEMIRDMGVGQSAVEQLAVYCVSLKKEYENLKEARKASGEVADKLRKDLFSSRSKLQTVYSELDQAKLELKSAQKDLQSADKEIMSLK
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: TRAIP
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000
Immunohistochemical staining of human cerebral cortex, kidney, liver and testis using Anti-TRAIP antibody HPA036261 (A) shows similar protein distribution across tissues to independent antibody HPA036262 (B).
Immunohistochemical staining of human liver using Anti-TRAIP antibody HPA036261.
Immunohistochemical staining of human testis using Anti-TRAIP antibody HPA036261.
Immunohistochemical staining of human cerebral cortex using Anti-TRAIP antibody HPA036261.
Immunohistochemical staining of human kidney using Anti-TRAIP antibody HPA036261.
HPA036261
HPA036261
HPA036261