Anti-ITGAE
Artikelnummer:
ATA-HPA036313
- Bilder (7)
| Artikelname: | Anti-ITGAE |
| Artikelnummer: | ATA-HPA036313 |
| Hersteller Artikelnummer: | HPA036313 |
| Alternativnummer: | ATA-HPA036313-100,ATA-HPA036313-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CD103, HUMINAE |
| integrin, alpha E (antigen CD103, human mucosal lymphocyte antigen 1, alpha polypeptide) |
| Anti-ITGAE |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 3682 |
| UniProt: | P38570 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | CEEDCFSNASVKVSYQLQTPEGQTDHPQPILDRYTEPFAIFQLPYEKACKNKLFCVAELQLATTVSQQELVVGLTKELTLN |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ITGAE |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human small intestine shows strong membranous positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human duodenum shows strong membranous positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human endometrium shows no positivity in glandular cells. |
|
|
Immunohistochemical staining of human testis shows moderate to strong membranous positivity in cells in seminiferous ducts. |
|
|
HPA036313-100ul |
|
|
HPA036313-100ul |
|
|
HPA036313-100ul |
Produktgarantie und fachkundiger Support
