Anti-TRAF3IP2 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA036352
Artikelname: Anti-TRAF3IP2 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA036352
Hersteller Artikelnummer: HPA036352
Alternativnummer: ATA-HPA036352-100,ATA-HPA036352-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: ACT1, C6orf2, C6orf4, C6orf5, C6orf6, CIKS, DKFZP586G0522
TRAF3 interacting protein 2
Anti-TRAF3IP2
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 10758
UniProt: O43734
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: KQDVEGAESQLDEDEHGLHTKYIHRMMQIEFIKQGSMNFRFIPVLFPNAKKEHVPTWLQNTHVYSWPKNKKNILLRLLR
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: TRAF3IP2
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus & vesicles.
Immunohistochemical staining of human rectum shows strong cytoplasmic positivity with a granular pattern in glandular cells.
Western blot analysis in control (vector only transfected HEK293T lysate) and TRAF3IP2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY407798).
HPA036352
HPA036352
HPA036352