Anti-GCLC

Artikelnummer: ATA-HPA036360
Artikelname: Anti-GCLC
Artikelnummer: ATA-HPA036360
Hersteller Artikelnummer: HPA036360
Alternativnummer: ATA-HPA036360-100,ATA-HPA036360-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: GCS, GLCL, GLCLC
glutamate-cysteine ligase, catalytic subunit
Anti-GCLC
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 2729
UniProt: P48506
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: FENSAYVVFVVLLTRVILSYKLDFLIPLSKVDENMKVAQKRDAVLQGMFYFRKDICKGGNAVVDGCGKAQNSTELAAEEYTLMSIDTIINGKEGVFPGLIP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: GCLC
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows positivity in nucleus.
Immunohistochemical staining of human urinary bladder shows strong positivity in urothelial cells.
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human cell line A-549
HPA036360-100ul
HPA036360-100ul
HPA036360-100ul