Anti-LCP2 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA036396
- Bilder (8)
| Artikelname: | Anti-LCP2 Antibody , Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA036396 |
| Hersteller Artikelnummer: | HPA036396 |
| Alternativnummer: | ATA-HPA036396-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | SLP-76, SLP76 |
| lymphocyte cytosolic protein 2 (SH2 domain containing leukocyte protein of 76kDa) |
| Anti-LCP2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 3937 |
| UniProt: | Q13094 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | GARFLNLTENDIQKFPKLRVPILSKLSQEINKNEERRSIFTRKPQVPRFPEETESHEEDNGGWSSFEEDDYESPNDDQDGE |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | LCP2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human lymph node and skeletal muscle tissues using Anti-LCP2 antibody. Corresponding LCP2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human lymph node shows high expression. |
|
|
Immunohistochemical staining of human skeletal muscle shows low expression as expected. |
|
|
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human cell line HEL |
|
|
HPA036396 |
|
|
|
|
|
HPA036396 |
|
|
HPA036396 |
Produktgarantie und fachkundiger Support
