Anti-DMGDH
Artikelnummer:
ATA-HPA036442
- Bilder (9)
| Artikelname: | Anti-DMGDH |
| Artikelnummer: | ATA-HPA036442 |
| Hersteller Artikelnummer: | HPA036442 |
| Alternativnummer: | ATA-HPA036442-100,ATA-HPA036442-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DMGDH |
| dimethylglycine dehydrogenase |
| Anti-DMGDH |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 29958 |
| UniProt: | Q9UI17 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | TLATDDVDPEGNESIWYNGKVVGNTTSGSYSYSIQKSLAFAYVPVQLSEVGQQVEVELLGKNYPAVIIQEPLVLTEPTRNRLQK |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | DMGDH |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human kidney and colon tissues using Anti-DMGDH antibody. Corresponding DMGDH RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human colon, kidney, liver and lymph node using Anti-DMGDH antibody HPA036442 (A) shows similar protein distribution across tissues to independent antibody HPA036441 (B). |
|
|
Immunohistochemical staining of human colon shows low expression as expected. |
|
|
Immunohistochemical staining of human kidney shows high expression. |
|
|
Immunohistochemical staining of human lymph node using Anti-DMGDH antibody HPA036442. |
|
|
Immunohistochemical staining of human liver using Anti-DMGDH antibody HPA036442. |
|
|
HPA036442-100ul |
|
|
HPA036442-100ul |
|
|
HPA036442-100ul |
Produktgarantie und fachkundiger Support
