Anti-DDX46
Artikelnummer:
ATA-HPA036554
- Bilder (8)
| Artikelname: | Anti-DDX46 |
| Artikelnummer: | ATA-HPA036554 |
| Hersteller Artikelnummer: | HPA036554 |
| Alternativnummer: | ATA-HPA036554-100,ATA-HPA036554-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ25329, KIAA0801, Prp5, PRPF5 |
| DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 |
| Anti-DDX46 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 9879 |
| UniProt: | Q7L014 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | KEGNEMEGEELDPLDAYMEEVKEEVKKFNMRSVKGGGGNEKKSGPTVTKVVTVVTTKKAVVDSDKKKGELMENDQDAM |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | DDX46 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human testis shows strong nuclear positivity in seminiferous tubules. |
|
|
Western blot analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-DDX46 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH. |
|
|
Western blot analysis using Anti-DDX46 antibody HPA036554 (A) shows similar pattern to independent antibody HPA057501 (B). |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA036554 |
|
|
|
|
|
HPA036554 |
|
|
HPA036554 |
Produktgarantie und fachkundiger Support
