Anti-FANCL

Artikelnummer: ATA-HPA036685
Artikelname: Anti-FANCL
Artikelnummer: ATA-HPA036685
Hersteller Artikelnummer: HPA036685
Alternativnummer: ATA-HPA036685-100,ATA-HPA036685-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FAAP43, FLJ10335, PHF9, Pog
Fanconi anemia, complementation group L
Anti-FANCL
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 55120
UniProt: Q9NW38
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: ALKNRQELYALPPPPQFYSSLIEEIGTLGWDKLVYADTCFSTIKLKAEDASGREHLITLKLKAKYPAESPDYFVDFPVPFC
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: FANCL
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear bodies & vesicles.
Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Western blot analysis in human cell line NTERA-2.
HPA036685-100ul
HPA036685-100ul
HPA036685-100ul