Anti-DNAH1
Artikelnummer:
ATA-HPA036806
- Bilder (4)
| Artikelname: | Anti-DNAH1 |
| Artikelnummer: | ATA-HPA036806 |
| Hersteller Artikelnummer: | HPA036806 |
| Alternativnummer: | ATA-HPA036806-100,ATA-HPA036806-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Molekularbiologie |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DNAHC1, HDHC7, HL-11, HL11, XLHSRF-1 |
| dynein, axonemal, heavy chain 1 |
| Anti-DNAH1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 25981 |
| UniProt: | Q9P2D7 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | RIVKVMDDYQVMDEFLYNLSSDDFNDKWIASNWPSKILGQIELVQQQHVEDEEKFRKIQIMDQNNFQEKLEGLQLVVAGFS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | DNAH1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human fallopian tube shows membranous positivity in glandular cells. |
|
|
HPA036806-100ul |
|
|
HPA036806-100ul |
|
|
HPA036806-100ul |
Produktgarantie und fachkundiger Support
