Anti-TAMM41
Artikelnummer:
ATA-HPA036834
- Bilder (7)
| Artikelname: | Anti-TAMM41 |
| Artikelnummer: | ATA-HPA036834 |
| Hersteller Artikelnummer: | HPA036834 |
| Alternativnummer: | ATA-HPA036834-100,ATA-HPA036834-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | C3orf31, DKFZp434E0519, MGC16471 |
| TAM41, mitochondrial translocator assembly and maintenance protein, homolog (S. cerevisiae) |
| Anti-TAMM41 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 132001 |
| UniProt: | Q96BW9 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MALQTLQSSWVTFRKILSHFPEELSLAFVYGSGVYRQAGPSSDQKNAMLDFVFTVDDPVAWHSKNLKKNWSHYSFL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | TAMM41 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human bronchus shows moderate cytoplasmic and membranous positivity in respiratory epithelial cells. |
|
|
Western blot analysis in human cell line PC-3. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and TAMM41 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY408493). |
|
|
HPA036834-100ul |
|
|
|
|
|
HPA036834-100ul |
|
|
HPA036834-100ul |
Produktgarantie und fachkundiger Support
