Anti-DNAJC13

Artikelnummer: ATA-HPA036923
Artikelname: Anti-DNAJC13
Artikelnummer: ATA-HPA036923
Hersteller Artikelnummer: HPA036923
Alternativnummer: ATA-HPA036923-100,ATA-HPA036923-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Molekularbiologie
Applikation: ICC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: KIAA0678, RME8
DnaJ (Hsp40) homolog, subfamily C, member 13
Anti-DNAJC13
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 23317
UniProt: O75165
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: VTPGGFDQINPATNRVLCSYDYRNIEGFVDLSDYQGGFCILYGGFSRLHLFASEQREEIIKSAIDHAGNYIGISLRIRKEPLEFEQYLNLRF
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: DNAJC13
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & vesicles.
HPA036923-100ul