Anti-RAI14
Artikelnummer:
ATA-HPA036950
- Bilder (9)
| Artikelname: | Anti-RAI14 |
| Artikelnummer: | ATA-HPA036950 |
| Hersteller Artikelnummer: | HPA036950 |
| Alternativnummer: | ATA-HPA036950-100,ATA-HPA036950-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DKFZp564G013, KIAA1334, NORPEG, RAI13 |
| retinoic acid induced 14 |
| Anti-RAI14 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 26064 |
| UniProt: | Q9P0K7 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | KAAMTDAMVPRSSYEKLQSSLESEVSVLASKLKESVKEKEKVHSEVVQIRSEVSQVKREKENIQTLLKSKEQEVNELLQKFQQAQEELAEMKRYAE |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | RAI14 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleus & cytosol. |
|
|
Immunohistochemical staining of human placenta shows strong membrane and cytoplasmic positivity in trophoblastic cells. |
|
|
Western blot analysis in human cell lines U2OS and MCF-7 using Anti-RAI14 antibody. Corresponding RAI14 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH. |
|
|
Western blot analysis using Anti-RAI14 antibody HPA036950 (A) shows similar pattern to independent antibody HPA036949 (B). |
|
|
HPA036950-100ul |
|
|
|
|
|
|
|
|
HPA036950-100ul |
|
|
HPA036950-100ul |
Produktgarantie und fachkundiger Support
