Anti-ASTE1

Artikelnummer: ATA-HPA037010
Artikelname: Anti-ASTE1
Artikelnummer: ATA-HPA037010
Hersteller Artikelnummer: HPA037010
Alternativnummer: ATA-HPA037010-100,ATA-HPA037010-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: HT001
asteroid homolog 1 (Drosophila)
Anti-ASTE1
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 28990
UniProt: Q2TB18
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: HSNEFFTDLKLRDTKIVIDGYALFHRLCFSSNLDLRYGGDYDSFADVVQKFFESLFACNICPYVVLDGGCDISDKKLTTLKDRAREKIQMAHSLSVGGSGY
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ASTE1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human epididymis and pancreas tissues using Anti-ASTE1 antibody. Corresponding ASTE1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human epididymis shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
Western blot analysis in control (vector only transfected HEK293T lysate) and ASTE1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY415490).
HPA037010
HPA037010
HPA037010