Anti-CGGBP1
Artikelnummer:
ATA-HPA037017
- Bilder (8)
| Artikelname: | Anti-CGGBP1 |
| Artikelnummer: | ATA-HPA037017 |
| Hersteller Artikelnummer: | HPA037017 |
| Alternativnummer: | ATA-HPA037017-100,ATA-HPA037017-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CGGBP, p20-CGGBP |
| CGG triplet repeat binding protein 1 |
| Anti-CGGBP1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 8545 |
| UniProt: | Q9UFW8 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | PLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSIPKSDQLRRAYLPDGYENENQLLNSQD |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CGGBP1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line RH-30 shows localization to nucleus. |
|
|
Immunohistochemical staining of human small intestine shows strong nuclear positivity in glandular cells. |
|
|
Western blot analysis using Anti-CGGBP1 antibody HPA037017 (A) shows similar pattern to independent antibody HPA035568 (B). |
|
|
HPA037017 |
|
|
|
|
|
|
|
|
HPA037017 |
|
|
HPA037017 |
Produktgarantie und fachkundiger Support
