Anti-DNA2
Artikelnummer:
ATA-HPA037487
| Artikelname: |
Anti-DNA2 |
| Artikelnummer: |
ATA-HPA037487 |
| Hersteller Artikelnummer: |
HPA037487 |
| Alternativnummer: |
ATA-HPA037487-100,ATA-HPA037487-25 |
| Hersteller: |
Atlas Antibodies |
| Wirt: |
Rabbit |
| Kategorie: |
Molekularbiologie |
| Applikation: |
IHC |
| Spezies Reaktivität: |
Human |
| Immunogen: |
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
DNA2L, KIAA0083 |
| DNA replication helicase/nuclease 2 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.3 mg/ml |
| Isotyp: |
IgG |
| NCBI: |
1763 |
| UniProt: |
P51530 |
| Puffer: |
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: |
Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: |
TVLSTGMDNRYLVLAVNTVQNKEGNCEKRLVITASQSLENKELCILRNDWCSVPVEPGDIIHLEGDCTSDTWIIDKDFGYLILY |
| Lagerung: |
Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: |
DNA2 |
| Antibody Type: |
Monoclonal Antibody |
| Application Verdünnung: |
IHC: 1:50 - 1:200 |
![]()
|
Immunohistochemical staining of human colon shows strong cytoplasmic(granular pattern) positivity in glandular cells. |
![]()
|
HPA037487-100ul |
