Anti-DNAH12

Artikelnummer: ATA-HPA037493
Artikelname: Anti-DNAH12
Artikelnummer: ATA-HPA037493
Hersteller Artikelnummer: HPA037493
Alternativnummer: ATA-HPA037493-100,ATA-HPA037493-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Molekularbiologie
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: DHC3, DLP12, DNAH12L, DNAH7L, Dnahc3, DNHD2, FLJ40427, FLJ44290, hdhc3, HL-19
dynein, axonemal, heavy chain 12
Anti-DNAH12
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 201625
UniProt: Q6ZR08
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: IHGLYLDGARWDRESGLLAEQYPKLLFDLMPIIWIKPTQKSRIIKSDAYVCP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: DNAH12
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000
Immunohistochemistry analysis in human fallopian tube and prostate tissues using Anti-DNAH12 antibody. Corresponding DNAH12 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex, fallopian tube, liver and prostate using Anti-DNAH12 antibody HPA037493 (A) shows similar protein distribution across tissues to independent antibody HPA058203 (B).
Immunohistochemical staining of human prostate shows low expression as expected.
Immunohistochemical staining of human fallopian tube shows high expression.
Immunohistochemical staining of human cerebral cortex using Anti-DNAH12 antibody HPA037493.
Immunohistochemical staining of human liver using Anti-DNAH12 antibody HPA037493.
HPA037493-100ul
HPA037493-100ul
HPA037493-100ul