Anti-ZFYVE27
Artikelnummer:
ATA-HPA037523
- Bilder (9)
| Artikelname: | Anti-ZFYVE27 |
| Artikelnummer: | ATA-HPA037523 |
| Hersteller Artikelnummer: | HPA037523 |
| Alternativnummer: | ATA-HPA037523-100,ATA-HPA037523-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ32919, SPG33 |
| zinc finger, FYVE domain containing 27 |
| Anti-ZFYVE27 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 118813 |
| UniProt: | Q5T4F4 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | RLRKRYPTNNFGNCTGCSATFSVLKKRRSCSNCGNSFCSRCCSFKVPKSSMGATAPEAQRETVFVCASCNQTLSK |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ZFYVE27 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human colon shows strong cytoplasmic granular positivity in glandular cells. |
|
|
Immunohistochemical staining of human fallopian tube shows strong cytoplasmic granular positivity in glandular cells. |
|
|
Immunohistochemical staining of human kidney shows strong cytoplasmic granular positivity in cells in tubules. |
|
|
Immunohistochemical staining of human pancreas shows moderate cytoplasmic granular positivity in exocrine glandular cells. |
|
|
Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp Lane 4: Human plasma (IgG/HSA depleted) Lane 5: Human liver tissue Lane 6: Human tonsil tissue |
|
|
HPA037523-100ul |
|
|
|
|
|
HPA037523-100ul |
|
|
HPA037523-100ul |
Produktgarantie und fachkundiger Support
