Anti-U2SURP
Artikelnummer:
ATA-HPA037546
- Bilder (8)
| Artikelname: | Anti-U2SURP |
| Artikelnummer: | ATA-HPA037546 |
| Hersteller Artikelnummer: | HPA037546 |
| Alternativnummer: | ATA-HPA037546-100,ATA-HPA037546-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | fSAPa, SR140 |
| U2 snRNP-associated SURP domain containing |
| Anti-U2SURP |
| Klonalität: | Polyclonal |
| Konzentration: | 0.4 mg/ml |
| Isotyp: | IgG |
| NCBI: | 23350 |
| UniProt: | O15042 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MVFCLNNAEAAEEIVDCITESLSILKTPLPKKIARLYLVSDVLYNSSAKVANASYYRKFFETKLCQIFSDLNATYRTIQGHLQSENFKQRV |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | U2SURP |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemical staining of human cerebral cortex, colon, liver and testis using Anti-U2SURP antibody HPA037546 (A) shows similar protein distribution across tissues to independent antibody HPA061407 (B). |
|
|
Immunohistochemical staining of human testis using Anti-U2SURP antibody HPA037546. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-U2SURP antibody HPA037546. |
|
|
Immunohistochemical staining of human colon using Anti-U2SURP antibody HPA037546. |
|
|
Immunohistochemical staining of human liver using Anti-U2SURP antibody HPA037546. |
|
|
HPA037546 |
|
|
HPA037546 |
|
|
HPA037546 |
Produktgarantie und fachkundiger Support
