Anti-BCS1L
Artikelnummer:
ATA-HPA037700
- Bilder (7)
| Artikelname: | Anti-BCS1L |
| Artikelnummer: | ATA-HPA037700 |
| Hersteller Artikelnummer: | HPA037700 |
| Alternativnummer: | ATA-HPA037700-100,ATA-HPA037700-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | BCS, BJS, h-BCS, Hs.6719 |
| BC1 (ubiquinol-cytochrome c reductase) synthesis-like |
| Anti-BCS1L |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 617 |
| UniProt: | Q9Y276 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | RVDLKEYVGYCSHWQLTQMFQRFYPGQAPSLAENFAEHVLRATNQISPAQVQGYFMLYKNDPVGAIHNAES |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | BCS1L |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human testis shows strong granular cytoplasmic positivity in Leydig cells. |
|
|
Immunohistochemical staining of human skin shows moderate positivity in cytoplasm in squamous epithelial cells. |
|
|
Immunohistochemical staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules. |
|
|
Immunohistochemical staining of human Fallopian tube shows moderate positivity in cytoplasm in glandular cells. |
|
|
HPA037700-100ul |
|
|
HPA037700-100ul |
|
|
HPA037700-100ul |
Produktgarantie und fachkundiger Support
