Anti-LSG1

Artikelnummer: ATA-HPA037704
Artikelname: Anti-LSG1
Artikelnummer: ATA-HPA037704
Hersteller Artikelnummer: HPA037704
Alternativnummer: ATA-HPA037704-100,ATA-HPA037704-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FLJ11301
large 60S subunit nuclear export GTPase 1
Anti-LSG1
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 55341
UniProt: Q9H089
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: SELNDGYDWGRLNLQSVTEQSSLDDFLATAELAGTEFVAEKLNIKFVPAEARTGLLSFEESQRIKKLHEENKQFLCIPRRPNWNQNTTPEE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: LSG1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus, nuclear bodies & cytosol.
Immunohistochemical staining of human cerebellum shows strong nuclear and cytoplasmic positivity in purkinje cells.
Western blot analysis using Anti-LSG1 antibody HPA037704 (A) shows similar pattern to independent antibody HPA037705 (B).
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA037704-100ul
HPA037704-100ul
HPA037704-100ul