Anti-POLR2H
Artikelnummer:
ATA-HPA037745
- Bilder (8)
| Artikelname: | Anti-POLR2H |
| Artikelnummer: | ATA-HPA037745 |
| Hersteller Artikelnummer: | HPA037745 |
| Alternativnummer: | ATA-HPA037745-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | RPB8 |
| polymerase (RNA) II (DNA directed) polypeptide H |
| Anti-POLR2H |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 5437 |
| UniProt: | P52434 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | AGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEY |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | POLR2H |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human thyroid gland and pancreas tissues using Anti-POLR2H antibody. Corresponding POLR2H RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human pancreas shows low expression as expected. |
|
|
Immunohistochemical staining of human thyroid gland shows high expression. |
|
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) |
|
|
HPA037745 |
|
|
|
|
|
HPA037745 |
|
|
HPA037745 |
Produktgarantie und fachkundiger Support
