Anti-CD8A

Artikelnummer: ATA-HPA037756
Artikelname: Anti-CD8A
Artikelnummer: ATA-HPA037756
Hersteller Artikelnummer: HPA037756
Alternativnummer: ATA-HPA037756-100,ATA-HPA037756-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CD8
CD8a molecule

Anti-CD8A

Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 925
UniProt: P01732
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: AASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPT
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CD8A
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000
Immunohistochemistry analysis in human spleen and skeletal muscle tissues using HPA037756 antibody. Corresponding CD8A RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human spleen shows moderate to strong positivity in lymphoid cells.
Immunohistochemical staining of human lymph node shows moderate to strong positivity in lymphoid cells.
Immunohistochemical staining of human small intestine shows moderate to strong positivity in lymphoid cells.
Immunohistochemical staining of human skeletal muscle shows no cytoplasmic positivity as expected.
HPA037756
HPA037756
HPA037756