Anti-CD8A
Artikelnummer:
ATA-HPA037756
- Bilder (8)
| Artikelname: | Anti-CD8A |
| Artikelnummer: | ATA-HPA037756 |
| Hersteller Artikelnummer: | HPA037756 |
| Alternativnummer: | ATA-HPA037756-100,ATA-HPA037756-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CD8 |
| CD8a molecule |
Anti-CD8A
|
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 925 |
| UniProt: | P01732 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | AASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPT |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CD8A |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemistry analysis in human spleen and skeletal muscle tissues using HPA037756 antibody. Corresponding CD8A RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human spleen shows moderate to strong positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human lymph node shows moderate to strong positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human small intestine shows moderate to strong positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no cytoplasmic positivity as expected. |
|
|
HPA037756 |
|
|
HPA037756 |
|
|
HPA037756 |
Produktgarantie und fachkundiger Support
