Anti-TNNT3 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA037810
Artikelname: Anti-TNNT3 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA037810
Hersteller Artikelnummer: HPA037810
Alternativnummer: ATA-HPA037810-100,ATA-HPA037810-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: AMCD2B, DA2B, DKFZp779M2348, FSSV
troponin T type 3 (skeletal, fast)
Anti-TNNT3
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 7140
UniProt: P45378
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: RKPLNIDHLGEDKLRDKAKELWETLHQLEIDKFEFGEKLKRQKYDITTLRSRIDQAQKHSKKAGTPAKGKVG
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: TNNT3
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human skeletal muscle and heart muscle tissues using Anti-TNNT3 antibody. Corresponding TNNT3 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human skeletal muscle shows high expression.
Immunohistochemical staining of human heart muscle shows low expression as expected.
Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
HPA037810
HPA037810
HPA037810