Anti-ARMC3

Artikelnummer: ATA-HPA037823
Artikelname: Anti-ARMC3
Artikelnummer: ATA-HPA037823
Hersteller Artikelnummer: HPA037823
Alternativnummer: ATA-HPA037823-100,ATA-HPA037823-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CT81, FLJ32827
armadillo repeat containing 3
Anti-ARMC3
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 219681
UniProt: Q5W041
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LLRSKNDEVRKHASWAVMVCAGDELTANELCRLGALDILEEVNVSGTRKNKFSEAAYNKLLNNNLSLKYSQTGYLSSSNIINDGFYDYGR
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ARMC3
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human fallopian tube and liver tissues using Anti-ARMC3 antibody. Corresponding ARMC3 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human fallopian tube, kidney, liver and testis using Anti-ARMC3 antibody HPA037823 (A) shows similar protein distribution across tissues to independent antibody HPA037824 (B).
Immunohistochemical staining of human fallopian tube shows high expression.
Immunohistochemical staining of human liver shows low expression as expected.
Immunohistochemical staining of human testis using Anti-ARMC3 antibody HPA037823.
Immunohistochemical staining of human kidney using Anti-ARMC3 antibody HPA037823.
HPA037823-100ul
HPA037823-100ul
HPA037823-100ul