Anti-COPG1
Artikelnummer:
ATA-HPA037866
- Bilder (8)
| Artikelname: | Anti-COPG1 |
| Artikelnummer: | ATA-HPA037866 |
| Hersteller Artikelnummer: | HPA037866 |
| Alternativnummer: | ATA-HPA037866-100,ATA-HPA037866-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | COPG |
| coatomer protein complex, subunit gamma 1 |
| Anti-COPG1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 22820 |
| UniProt: | Q9Y678 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MLPSILVLLKRCVMDDDNEVRDRATFYLNVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEPSEKPFDLKSVPL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | COPG1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to the Golgi apparatus. |
|
|
Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in cells in tubules. |
|
|
Western blot analysis using Anti-COPG1 antibody HPA037866 (A) shows similar pattern to independent antibody HPA037867 (B). |
|
|
HPA037866-100ul |
|
|
|
|
|
|
|
|
HPA037866-100ul |
|
|
HPA037866-100ul |
Produktgarantie und fachkundiger Support
