Anti-TRUB1

Artikelnummer: ATA-HPA037914
Artikelname: Anti-TRUB1
Artikelnummer: ATA-HPA037914
Hersteller Artikelnummer: HPA037914
Alternativnummer: ATA-HPA037914-100,ATA-HPA037914-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: PUS4
TruB pseudouridine (psi) synthase family member 1
Anti-TRUB1
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 142940
UniProt: Q8WWH5
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: TDTLDSTGRVTEEKPYDKITQEDIEGILQKFTGNIMQVPPLYSALKKDGQRLSTLMKRGEVVEAKPARPVTVYSISLQKFQPPFFTLDVECGGG
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: TRUB1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to actin filaments.
Immunohistochemical staining of human colon shows moderate cytoplasmic positivity in glandular cells.
Western blot analysis in control (vector only transfected HEK293T lysate) and TRUB1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY408372).
HPA037914-100ul
HPA037914-100ul
HPA037914-100ul