Anti-SH3PXD2A
Artikelnummer:
ATA-HPA037923
- Bilder (9)
| Artikelname: | Anti-SH3PXD2A |
| Artikelnummer: | ATA-HPA037923 |
| Hersteller Artikelnummer: | HPA037923 |
| Alternativnummer: | ATA-HPA037923-100,ATA-HPA037923-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FISH, KIAA0418, SH3MD1 |
| SH3 and PX domains 2A |
| Anti-SH3PXD2A |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 9644 |
| UniProt: | Q5TCZ1 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | PDPSGKELDTVPAKGRQNEGKSDSLEKIERRVQALNTVNQSKKATPPIPSKPPGGFGKTSGTPAVKMRNGVRQVAVRPQSVFVSP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SH3PXD2A |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human cervix, uterine shows moderate cytoplasmic positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells. |
|
|
Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human pancreas shows very weak positivity in exocrine glandular cells and strong positivity in endocrine glandular cells. |
|
|
Western blot analysis in human cell line HeLa. |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
|
|
|
HPA037923-100ul |
|
|
HPA037923-100ul |
Produktgarantie und fachkundiger Support
