Anti-DYDC2

Artikelnummer: ATA-HPA038006
Artikelname: Anti-DYDC2
Artikelnummer: ATA-HPA038006
Hersteller Artikelnummer: HPA038006
Alternativnummer: ATA-HPA038006-100,ATA-HPA038006-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: bA36D19.6, MGC16186
DPY30 domain containing 2
Anti-DYDC2
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 84332
UniProt: Q96IM9
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: TIFMQEDTNPLEKEALKQEFLPGTSSLIPGMPQQVPPSESAGQIDQNFKMPQEINYKEAFQHEVAHEMPPGSKSP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: DYDC2
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human fallopian tube and tonsil tissues using Anti-DYDC2 antibody. Corresponding DYDC2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human tonsil shows low expression as expected.
Immunohistochemical staining of human fallopian tube shows high expression.
Western blot analysis in control (vector only transfected HEK293T lysate) and DYDC2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY410165).
HPA038006-100ul
HPA038006-100ul
HPA038006-100ul