Anti-RASSF8
Artikelnummer:
ATA-HPA038164
- Bilder (7)
| Artikelname: | Anti-RASSF8 |
| Artikelnummer: | ATA-HPA038164 |
| Hersteller Artikelnummer: | HPA038164 |
| Alternativnummer: | ATA-HPA038164-100,ATA-HPA038164-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | C12orf2, HoJ-1 |
| Ras association (RalGDS/AF-6) domain family (N-terminal) member 8 |
| Anti-RASSF8 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 11228 |
| UniProt: | Q8NHQ8 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | KQLKDQLQEIRQKITECENKLKDYLAQIRTMESGLEAEKLQREVQEAQVNEEEVKGKIGKVKGEIDIQGQQSLRLENGIKAVERSLGQATKRLQDKEQE |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | RASSF8 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & mitochondria. |
|
|
Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis in human cell lines PC-3 and A-549 using Anti-RASSF8 antibody. Corresponding RASSF8 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
|
HPA038164-100ul |
|
|
HPA038164-100ul |
|
|
HPA038164-100ul |
Produktgarantie und fachkundiger Support
