Anti-ACAN
Artikelnummer:
ATA-HPA038241
- Bilder (8)
| Artikelname: | Anti-ACAN |
| Artikelnummer: | ATA-HPA038241 |
| Hersteller Artikelnummer: | HPA038241 |
| Alternativnummer: | ATA-HPA038241-100,ATA-HPA038241-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | AGC1, CSPG1, CSPGCP, MSK16 |
| aggrecan |
| Anti-ACAN |
| Klonalität: | Polyclonal |
| Konzentration: | 0.5 mg/ml |
| Isotyp: | IgG |
| NCBI: | 176 |
| UniProt: | None |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LPLPRNITEGEARGSVILTVKPIFEVSPSPLEPEEPFTFAPEIGATAFAEVENETGEATRPWGFPTPG |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ACAN |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemical staining of human cerebral cortex, esophagus, rectum and soft tissues using Anti-ACAN antibody HPA038241 (A) shows similar protein distribution across tissues to independent antibody HPA038242 (B). |
|
|
Immunohistochemical staining of human rectum using Anti-ACAN antibody HPA038241. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-ACAN antibody HPA038241. |
|
|
Immunohistochemical staining of human esophagus using Anti-ACAN antibody HPA038241. |
|
|
Immunohistochemical staining of human soft tissues using Anti-ACAN antibody HPA038241. |
|
|
HPA038241-100ul |
|
|
HPA038241-100ul |
|
|
HPA038241-100ul |
Produktgarantie und fachkundiger Support
