Anti-HPD
Artikelnummer:
ATA-HPA038321
- Bilder (8)
| Artikelname: | Anti-HPD |
| Artikelnummer: | ATA-HPA038321 |
| Hersteller Artikelnummer: | HPA038321 |
| Alternativnummer: | ATA-HPA038321-100,ATA-HPA038321-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | 4-HPPD, 4HPPD, GLOD3, PPD |
| 4-hydroxyphenylpyruvate dioxygenase |
| Anti-HPD |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 3242 |
| UniProt: | None |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MTTYSDKGAKPERGRFLHFHSVTFWVGNAKQATSFYCSKMGFEPLAYRGLETGSREVVSHVIKQGKIVFVLSSALNPWNKEMGDHLVKHGDG |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | HPD |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human liver and duodenum tissues using Anti-HPD antibody. Corresponding HPD RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human duodenum shows low expression as expected. |
|
|
Immunohistochemical staining of human liver shows high expression. |
|
|
Western blot analysis using Anti-HPD antibody HPA038321 (A) shows similar pattern to independent antibody HPA038322 (B). |
|
|
|
|
|
HPA038321-100ul |
|
|
HPA038321-100ul |
|
|
HPA038321-100ul |
Produktgarantie und fachkundiger Support
