Anti-CD99L2

Artikelnummer: ATA-HPA038782
Artikelname: Anti-CD99L2
Artikelnummer: ATA-HPA038782
Hersteller Artikelnummer: HPA038782
Alternativnummer: ATA-HPA038782-100,ATA-HPA038782-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CD99B, MIC2L1
CD99 molecule-like 2
Anti-CD99L2
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 83692
UniProt: Q8TCZ2
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: DDRNDRDDGRRKPIAGGGGFSDKDLEDIVGGGEYKPDKGKGDGRYGSNDDPGSGMVAEP
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CD99L2
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:20 - 1:50
Immunohistochemistry analysis in human cerebral cortex and tonsil tissues using Anti-CD99L2 antibody. Corresponding CD99L2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human tonsil shows low expression as expected.
Immunohistochemical staining of human cerebral cortex shows high expression.
Western blot analysis in control (vector only transfected HEK293T lysate) and CD99L2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY410504).
HPA038782-100ul
HPA038782-100ul
HPA038782-100ul