Anti-NRIP2
Artikelnummer:
ATA-HPA039197
- Bilder (9)
| Artikelname: | Anti-NRIP2 |
| Artikelnummer: | ATA-HPA039197 |
| Hersteller Artikelnummer: | HPA039197 |
| Alternativnummer: | ATA-HPA039197-100,ATA-HPA039197-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DKFZP761G1913 |
| nuclear receptor interacting protein 2 |
| Anti-NRIP2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 83714 |
| UniProt: | Q9BQI9 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LDSLKRLGTSKDLQPRSVIQRRLVEGNPNWLQGEPPRMQDLIHGQESRRKTSRTEIPALLVNCKCQDQLLRV |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | NRIP2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human ovary and liver tissues using Anti-NRIP2 antibody. Corresponding NRIP2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human colon, liver, ovary and testis using Anti-NRIP2 antibody HPA039197 (A) shows similar protein distribution across tissues to independent antibody HPA039860 (B). |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
Immunohistochemical staining of human ovary shows high expression. |
|
|
Immunohistochemical staining of human colon using Anti-NRIP2 antibody HPA039197. |
|
|
Immunohistochemical staining of human testis using Anti-NRIP2 antibody HPA039197. |
|
|
HPA039197-100ul |
|
|
HPA039197-100ul |
|
|
HPA039197-100ul |
Produktgarantie und fachkundiger Support
