Anti-UNC45A
Artikelnummer:
ATA-HPA039228
- Bilder (8)
| Artikelname: | Anti-UNC45A |
| Artikelnummer: | ATA-HPA039228 |
| Hersteller Artikelnummer: | HPA039228 |
| Alternativnummer: | ATA-HPA039228-100,ATA-HPA039228-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | GC-UNC45, SMAP-1 |
| unc-45 homolog A (C. elegans) |
| Anti-UNC45A |
| Klonalität: | Polyclonal |
| Konzentration: | 1.0 mg/ml |
| Isotyp: | IgG |
| NCBI: | 55898 |
| UniProt: | Q9H3U1 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | QELQHRGAVVVLNMVEASREIASTLMESEMMEILSVLAKGDHSPVTRAAAACLDKAVEYGLIQPNQDG |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | UNC45A |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line HEK 293 shows localization to cytosol & the Golgi apparatus. |
|
|
Immunohistochemical staining of human bone marrow shows strong cytoplasmic positivity in megakaryocytes. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
|
HPA039228-100ul |
|
|
|
|
|
|
|
|
HPA039228-100ul |
|
|
HPA039228-100ul |
Produktgarantie und fachkundiger Support
