Anti-TRAFD1

Artikelnummer: ATA-HPA039266
Artikelname: Anti-TRAFD1
Artikelnummer: ATA-HPA039266
Hersteller Artikelnummer: HPA039266
Alternativnummer: ATA-HPA039266-100,ATA-HPA039266-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FLN29
TRAF-type zinc finger domain containing 1
Anti-TRAFD1
Klonalität: Polyclonal
Konzentration: 0.4 mg/ml
Isotyp: IgG
NCBI: 10906
UniProt: O14545
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: PVEESIIIPCEFCGVQLEEEVLFHHQDQCDQRPATATNHVTEGIPRLDSQPQETSPELPRRRVRHQGDLSSGYLDDTKQETANGPTSCLPPSRPINNMTATYNQLSRS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: TRAFD1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human testis and skeletal muscle tissues using Anti-TRAFD1 antibody. Corresponding TRAFD1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows high expression.
Immunohistochemical staining of human skeletal muscle shows low expression as expected.
Western blot analysis in control (vector only transfected HEK293T lysate) and TRAFD1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402005).
HPA039266-100ul
HPA039266-100ul
HPA039266-100ul